DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and emb1644

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_198124.1 Gene:emb1644 / 832834 AraportID:AT5G27720 Length:129 Species:Arabidopsis thaliana


Alignment Length:127 Identity:82/127 - (64%)
Similarity:94/127 - (74%) Gaps:0/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||.||||||||||||||||||:||:||||:||:|||||||||||||||||||||:|
plant     1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNT 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQGYG 127
            |||||:||||||.|:|:.....|....:.:.||.........||..|.:...:|...|.|.|
plant    66 IKYLRVPDEVIDKVQEEKTRTDRKPPGVGRGRGRGVDDGGARGRGRGTSMGKMGGNRGAGRG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 67/74 (91%)
emb1644NP_198124.1 LSm4 2..77 CDD:212470 67/74 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1673
eggNOG 1 0.900 - - E1_KOG3293
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I1517
OMA 1 1.010 - - QHG55325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005075
OrthoInspector 1 1.000 - - oto3995
orthoMCL 1 0.900 - - OOG6_102392
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4115
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.