DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and Lsm4

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_056631.2 Gene:Lsm4 / 50783 MGIID:1354692 Length:138 Species:Mus musculus


Alignment Length:148 Identity:97/148 - (65%)
Similarity:108/148 - (72%) Gaps:18/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
Mouse     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGR-PGGGNRNNVGNRPGQGYGGA 129
            |||||||||:||||:|:| ||.|       .|||...|.|:.|| .||..|...|   |:|.||.
Mouse    66 IKYLRIPDEIIDMVREEA-AKGR-------GRGGPQQQKQQKGRGMGGAGRGVFG---GRGRGGI 119

  Fly   130 ANNAMRLGGAAGQGNRLP 147
            .      |...||..:.|
Mouse   120 P------GAGRGQPEKKP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 68/74 (92%)
Lsm4NP_056631.2 LSm4 2..77 CDD:212470 68/74 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838092
Domainoid 1 1.000 134 1.000 Domainoid score I5020
eggNOG 1 0.900 - - E1_KOG3293
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I3965
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005075
OrthoInspector 1 1.000 - - oto93094
orthoMCL 1 0.900 - - OOG6_102392
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4115
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.660

Return to query results.
Submit another query.