DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and lsm4

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_989371.1 Gene:lsm4 / 395002 XenbaseID:XB-GENE-945533 Length:138 Species:Xenopus tropicalis


Alignment Length:148 Identity:95/148 - (64%)
Similarity:107/148 - (72%) Gaps:18/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
 Frog     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQG-YGGA 129
            |||||||||:||||||:..:|.|       .|||...|.|..||..||        .|:| :||.
 Frog    66 IKYLRIPDEIIDMVKEEVMSKGR-------GRGGMQQQKQMKGRGAGG--------AGRGVFGGR 115

  Fly   130 ANNAMRLGGAAGQGNRLP 147
            .....  ||..||.::.|
 Frog   116 GRGVP--GGGRGQQDKKP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 68/74 (92%)
lsm4NP_989371.1 LSm4 2..77 CDD:212470 68/74 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4995
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005075
OrthoInspector 1 1.000 - - oto103346
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R668
SonicParanoid 1 1.000 - - X4115
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.