DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and lsm4

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_956990.1 Gene:lsm4 / 393669 ZFINID:ZDB-GENE-040426-1652 Length:143 Species:Danio rerio


Alignment Length:147 Identity:95/147 - (64%)
Similarity:109/147 - (74%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
Zfish     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQGYGGAA 130
            |||||||||:||||||:..:|.|.|..|.:|:      .|..||.||..|   |..||:|..|..
Zfish    66 IKYLRIPDEIIDMVKEEVVSKGRGRGGMQQNK------PQGKGRGGGPGR---GGGPGRGVFGGR 121

  Fly   131 NNAMRLGGAAGQGNRLP 147
            ...|:..|...|.::.|
Zfish   122 GRGMQGSGRGQQQDKKP 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 68/74 (92%)
lsm4NP_956990.1 LSm4 2..77 CDD:212470 68/74 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581904
Domainoid 1 1.000 134 1.000 Domainoid score I4994
eggNOG 1 0.900 - - E1_KOG3293
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3886
OMA 1 1.010 - - QHG55325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005075
OrthoInspector 1 1.000 - - oto38911
orthoMCL 1 0.900 - - OOG6_102392
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R668
SonicParanoid 1 1.000 - - X4115
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.690

Return to query results.
Submit another query.