DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and LSM4

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_036453.1 Gene:LSM4 / 25804 HGNCID:17259 Length:139 Species:Homo sapiens


Alignment Length:155 Identity:97/155 - (62%)
Similarity:108/155 - (69%) Gaps:21/155 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
Human     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQG-YGGA 129
            |||||||||:||||||:..||.|       .|||...|.|:.||..||        .|:| :||.
Human    66 IKYLRIPDEIIDMVKEEVVAKGR-------GRGGLQQQKQQKGRGMGG--------AGRGVFGGR 115

  Fly   130 ANNAMRLGGAAGQGNRLPHAAKNRK 154
            ..     ||..|.|...|.....|:
Human   116 GR-----GGIPGTGRGQPEKKPGRQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 68/74 (92%)
LSM4NP_036453.1 LSm4 2..77 CDD:212470 68/74 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..139 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148000
Domainoid 1 1.000 134 1.000 Domainoid score I5044
eggNOG 1 0.900 - - E1_KOG3293
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3960
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005075
OrthoInspector 1 1.000 - - oto89524
orthoMCL 1 0.900 - - OOG6_102392
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R668
SonicParanoid 1 1.000 - - X4115
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.