DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and smd3

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_595699.1 Gene:smd3 / 2540884 PomBaseID:SPBC19C2.14 Length:97 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:30/72 - (41%)
Similarity:45/72 - (62%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGSTI 66
            |.:.||...|.|.:.:||:||.||.|.|:..:..||..:||:..|::|| |...:.:.|||||.|
pombe     3 LCIKLLHETQGHIVTMELENGSTYRGKLIEAEDNMNCQMRDISVTARDG-RVSHLDQVYIRGSHI 66

  Fly    67 KYLRIPD 73
            ::|.:||
pombe    67 RFLIVPD 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 30/72 (42%)
smd3NP_595699.1 Sm_D3 5..73 CDD:212468 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.