powered by:
Protein Alignment CG17768 and lsm-5
DIOPT Version :9
Sequence 1: | NP_001027236.1 |
Gene: | CG17768 / 3772012 |
FlyBaseID: | FBgn0032240 |
Length: | 154 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001366865.1 |
Gene: | lsm-5 / 180047 |
WormBaseID: | WBGene00003079 |
Length: | 91 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 34/71 - (47%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVI--CTSKDGDRFWRMPECYIRG 63
:|||.|:.......:.|.:||.:...|.|...|.::|:.|.||: ..:.||.|..::....:.|
Worm 12 LLPLELIDKCIGSKIWVIMKNDKEIVGTLTGFDDYVNMVLEDVVEYENTADGKRMTKLDTILLNG 76
Fly 64 STIKYL 69
:.|..|
Worm 77 NHITML 82
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17768 | NP_001027236.1 |
LSm4 |
2..77 |
CDD:212470 |
20/70 (29%) |
lsm-5 | NP_001366865.1 |
LSm5 |
11..86 |
CDD:212479 |
20/71 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.