DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and lsm-4

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_495514.1 Gene:lsm-4 / 174193 WormBaseID:WBGene00003078 Length:123 Species:Caenorhabditis elegans


Alignment Length:126 Identity:79/126 - (62%)
Similarity:99/126 - (78%) Gaps:8/126 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            :||||||||||:|||||||||||||||||.:|||||||:|.|||.||||||:|::|.|.|:||||
 Worm     2 VLPLSLLKTAQNHPMLVELKNGETYNGHLKACDSWMNIHLVDVIFTSKDGDKFFKMSEAYVRGST 66

  Fly    66 IKYLRIPDEVIDMVKEDA-QAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQG 125
            |||||||:.|:|:||.:. :.:.:.:.|.::.|||.     ||||  ||:|...|||.|:|
 Worm    67 IKYLRIPETVVDLVKTEVNEVRRQQQREQSRGRGGG-----RGGR--GGHRGGGGNRGGRG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 60/74 (81%)
lsm-4NP_495514.1 LSm4 3..78 CDD:212470 60/74 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159945
Domainoid 1 1.000 114 1.000 Domainoid score I3814
eggNOG 1 0.900 - - E1_KOG3293
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H136453
Inparanoid 1 1.050 158 1.000 Inparanoid score I2897
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55325
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005075
OrthoInspector 1 1.000 - - oto17272
orthoMCL 1 0.900 - - OOG6_102392
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R668
SonicParanoid 1 1.000 - - X4115
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.690

Return to query results.
Submit another query.