DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG14456

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:76 Identity:14/76 - (18%)
Similarity:26/76 - (34%) Gaps:16/76 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LDACLLLGSIQKNRLVNIYSKTFKRFSNV--ECPL--------------KANFNYTMKNLYMDEQ 140
            |:.|.:||...|:.:........:.|.|:  .||:              |...:|.:...:..|.
  Fly    91 LNVCRILGFANKSPVGRFVHGFIREFGNIVETCPIAKGRYHWHRIHLKRKLQGSYFINKFWWPED 155

  Fly   141 DFPSFVPSGTF 151
            ...:.:|...|
  Fly   156 PTTAMLPELEF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 14/76 (18%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 14/76 (18%)

Return to query results.
Submit another query.