DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33632

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:174 Identity:42/174 - (24%)
Similarity:68/174 - (39%) Gaps:46/174 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FRIVVDHISTKIFDTKTIETLGCQ-VD-----------QSSNRSYVNCHM---LLNREVGKFDAR 72
            |:::..:..|:::.......:.|: :|           ||.||||....:   ||...|.|...:
  Fly    11 FQLICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQ 75

  Fly    73 NVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNVE--CPLKANFNYTMKNL 135
            ..| :.|.||.:..||...||.|..|.|...|.:...:...||.:||:.  ||    :|:   :|
  Fly    76 FGL-YKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCP----YNH---DL 132

  Fly   136 YMDEQDFPSF---------VPSGTF------------RSLIEFY 158
            .:||..:.|.         .|.|.:            |::..||
  Fly   133 VLDEMSYHSINYKLTEILPFPEGNYKLEVHWIAYDIDRAITTFY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 24/95 (25%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 25/88 (28%)

Return to query results.
Submit another query.