DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33640

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:147 Identity:46/147 - (31%)
Similarity:76/147 - (51%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVVDHISTKIFDTKTIETLGCQVDQSSNRSYVNCHMLLNREVGKFDARNVLDFVRPNGQEMKLYE 89
            :.|||.:..:.|.....:....|:|..||||::.||::||.|......:.:|..||...|::||.
  Fly    24 VFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSSMDITRPQRPELRLYN 88

  Fly    90 GRLDACLLLGSIQKNRLVNIYSKTFKRFSNV--ECPLKANFNYTMKNLYMDEQDFPSFVPSGTFR 152
            .:|:.|.:|.:..||:.:.:....:.:|.|.  :||||.||||::...|:||...|..:|..|:|
  Fly    89 VQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPDLLPECTYR 153

  Fly   153 SLIEFYLNQTFIASRAI 169
            ..:.|......:|...|
  Fly   154 LKMSFKHKSKLLAHMQI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 26/74 (35%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 27/80 (34%)

Return to query results.
Submit another query.