DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33923

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:24/53 - (45%) Gaps:2/53 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNV--ECP 123
            ||....|.||.:..||...:|||....:.:.|.:.......||.:||:  .||
  Fly    73 NVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 15/47 (32%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 17/53 (32%)

Return to query results.
Submit another query.