DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33795

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:130 Identity:35/130 - (26%)
Similarity:55/130 - (42%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QSSNRSYV---NCHMLL---NREVGKFDAR-------NVLDF---VRPNGQEMKLYEGRLDACLL 97
            :|.|:|:|   .|.:..   ||.|..|:|.       .|:|:   .|.||.:..||:..:|.|..
  Fly    34 ESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRF 98

  Fly    98 LGSIQKNRLVNIYSKTFKRFSNVE--CPLKANFNYTMKNLYMDEQDFPSFVPSGTFRSLI--EFY 158
            |.. ..:.|..:....||.|||:.  ||...:.  .::.:|:..:......|||.:...|  .||
  Fly    99 LRK-PYDMLTKMIYMVFKPFSNINHTCPFYGDI--LIRGMYLRTEIKAMPYPSGKYMLQINWSFY 160

  Fly   159  158
              Fly   161  160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 20/74 (27%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 20/78 (26%)

Return to query results.
Submit another query.