DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33679

DIOPT Version :9

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:177 Identity:38/177 - (21%)
Similarity:69/177 - (38%) Gaps:46/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTLFWLYCFLI-----------LYCVDSAQRNFRIVVDHISTKIFDTKTIETLGCQVDQSSNRS 54
            |..|.|:....|           |.| :|..::|         .:|....::.||        |.
  Fly     1 MKYLLWISLLFIGESHGYVRLTNLKC-ESYDKSF---------VVFPECRLKVLG--------RG 47

  Fly    55 YV--NCHMLL-----NREVGKFDARNVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSK 112
            .:  |.|:.|     ||.|.:|     :.:.:.||....|:....:.|.:|....:.|:...:..
  Fly    48 IIGANIHVKLLKLPINRMVVRF-----ITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYT 107

  Fly   113 TFKRFSNVE--CPLKANFNYTMKNLYMDEQDFPSF-VPSGTFRSLIE 156
            .|..|||:.  ||.  |.:..::|..:|::.|... :|.|:::..:|
  Fly   108 AFMPFSNINHTCPY--NDDIYIRNCTLDDRMFAKVPLPKGSYKLTLE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 18/79 (23%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.