DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33679

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:177 Identity:38/177 - (21%)
Similarity:69/177 - (38%) Gaps:46/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTLFWLYCFLI-----------LYCVDSAQRNFRIVVDHISTKIFDTKTIETLGCQVDQSSNRS 54
            |..|.|:....|           |.| :|..::|         .:|....::.||        |.
  Fly     1 MKYLLWISLLFIGESHGYVRLTNLKC-ESYDKSF---------VVFPECRLKVLG--------RG 47

  Fly    55 YV--NCHMLL-----NREVGKFDARNVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSK 112
            .:  |.|:.|     ||.|.:|     :.:.:.||....|:....:.|.:|....:.|:...:..
  Fly    48 IIGANIHVKLLKLPINRMVVRF-----ITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYT 107

  Fly   113 TFKRFSNVE--CPLKANFNYTMKNLYMDEQDFPSF-VPSGTFRSLIE 156
            .|..|||:.  ||.  |.:..::|..:|::.|... :|.|:::..:|
  Fly   108 AFMPFSNINHTCPY--NDDIYIRNCTLDDRMFAKVPLPKGSYKLTLE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 18/75 (24%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 18/80 (23%)

Return to query results.
Submit another query.