powered by:
Protein Alignment CG33643 and CG33914
DIOPT Version :9
Sequence 1: | NP_001027258.1 |
Gene: | CG33643 / 3772011 |
FlyBaseID: | FBgn0053643 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027394.2 |
Gene: | CG33914 / 3772464 |
FlyBaseID: | FBgn0053914 |
Length: | 189 |
Species: | Drosophila melanogaster |
Alignment Length: | 31 |
Identity: | 11/31 - (35%) |
Similarity: | 14/31 - (45%) |
Gaps: | 8/31 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 CLLLGSIQKNRLVNIYSKTFKRFSNVECPLK 125
|||. |..::. .|.||:||.|..|
Fly 14 CLLF-------LTELHG-VFMRFTNVTCESK 36
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33643 | NP_001027258.1 |
DUF1091 |
75..152 |
CDD:284008 |
11/31 (35%) |
CG33914 | NP_001027394.2 |
DUF1091 |
85..166 |
CDD:284008 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.