DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33758

DIOPT Version :9

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:151 Identity:42/151 - (27%)
Similarity:61/151 - (40%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FDTKTIETLGCQVDQSSN-RSYVNCHMLLNREVGKFDARNVLDFV-RPNGQEMKLYEGRLDAC-- 95
            ||....|.|.|::...|. |:.::....|.:.|.|...|  |:|. |.||....||....:.|  
  Fly    29 FDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFIR--LEFFKRANGWRPFLYNFTANLCDF 91

  Fly    96 ------LLLG---SIQKNRLVNIYSKTFKRFSN--VECPLKANFNYTMKNLYMDEQDFPSFVPSG 149
                  :::|   :..:..||..||..||...|  :||   .:|...:.||   ...||  :.:|
  Fly    92 LARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLEC---KDFELDINNL---RNRFP--IETG 148

  Fly   150 TFRSLIEFYLNQTFIASRAIA 170
                  |:.|..||||....|
  Fly   149 ------EYALQLTFIAKNKAA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 24/90 (27%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.