DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33798

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:142 Identity:32/142 - (22%)
Similarity:55/142 - (38%) Gaps:31/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CQVDQSSNRSY----VNCHMLLNREVGKFDARNVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNR 105
            |:: :|.||:|    :..| |....|.:... |...:.|.||.:..||...:|.|..:.:...|.
  Fly    41 CRL-KSVNRTYKYISLKVH-LFQTPVNQIKV-NTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNP 102

  Fly   106 LVNIYSKTFKRFSNV--ECPLKANFNYTMKNLYMDEQDF------PSFVPSGTF----------- 151
            :.......||..:|:  .||.  :.:..|:.|..:..:|      |  .|.|.:           
  Fly   103 VTKFIFGVFKDATNMNHSCPY--DHDIIMEKLSAESINFQITKILP--FPEGKYMVKMNWFAYDI 163

  Fly   152 -RSLIEFYLNQT 162
             |::|..|:..|
  Fly   164 NRAIIRLYITLT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 19/92 (21%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 20/89 (22%)

Return to query results.
Submit another query.