DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33642

DIOPT Version :9

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:176 Identity:71/176 - (40%)
Similarity:106/176 - (60%) Gaps:4/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLFWLYCFLILYCVDSAQRNFRIVVDHISTKIFDTKTIETLGCQVDQSSNRSYVNCHMLLNREVG 67
            |||||..|....|:...:|:|||.::..:.|......|:.:..::...:||||||..|::..:|.
  Fly     8 TLFWLLWFTNHICLKCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVE 72

  Fly    68 KFDARNVLDFVRPNGQ-EMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKR--FSNVECPLKANFN 129
            .......:||.:.:.| ::|||:||||||..|.:..:|.|..||.|:||:  ..|:.|||:.|||
  Fly    73 DILMHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFN 137

  Fly   130 YTMKNLYMDEQDFPSFVPSGTFRSLIEFYLNQTFIASRAIARGKVM 175
            ||:.|.:|||:|.|.|||.||||::.| |..|..:|.|.:.:|||:
  Fly   138 YTLTNWHMDEKDLPPFVPLGTFRTVTE-YFTQDRLALRIVTQGKVL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 40/79 (51%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 40/80 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450148
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.