DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33643 and CG33453

DIOPT Version :10

Sequence 1:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:121 Identity:30/121 - (24%)
Similarity:52/121 - (42%) Gaps:17/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSNRSYVNCHMLLNREVGKFDARNVLDFV-RPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKT 113
            |.|::.:|.:............|  |..| |.:|.:..|::..:|||..|.. :.|.::.::...
  Fly    53 SRNKTSLNINATFLHPTNNVSLR--LKMVKRLSGYKPFLFDVTIDACQFLRK-RHNPVIKMFYSF 114

  Fly   114 FKRFS--NVECP--LKANFNYTMKNLYMDEQDFPSFVPSGTFRSLIE--FYLNQTF 163
            .|.:|  |..||  |:...:|       ....||..:|||.:..|::  ||..:.|
  Fly   115 IKDYSTLNHTCPYGLQVVSDY-------HTAVFPVPLPSGDYGVLLDFIFYAKKQF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 20/76 (26%)
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 21/78 (27%)

Return to query results.
Submit another query.