DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and Pop7

DIOPT Version :9

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_083029.1 Gene:Pop7 / 74097 MGIID:1921347 Length:140 Species:Mus musculus


Alignment Length:120 Identity:53/120 - (44%)
Similarity:76/120 - (63%) Gaps:15/120 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KQQNHRVVRKQPPRPAVSDRHNIYITSKTDFKAQQRRCEELINSGAH------EIFLHCMGFSVT 78
            |:..||:    |.||     ::||:..|||||||..||::|::.|..      ||::|.:|.::.
Mouse    24 KRLPHRL----PRRP-----NDIYVNMKTDFKAQLARCQKLLDGGTRGQNACTEIYIHGLGLAIN 79

  Fly    79 RGLNIALRLVQNSDGALSYAINTSTVQLVDELHPLCDAEDITFRQRNNSALHIKI 133
            |.:||||:|...|.|:|..|.|||||:|||||.|..|:.:...|.|||||:||::
Mouse    80 RAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDSREPLTRVRNNSAIHIRV 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 39..132 CDD:289126 46/98 (47%)
Pop7NP_083029.1 Rpp20 33..133 CDD:315086 48/104 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833226
Domainoid 1 1.000 63 1.000 Domainoid score I10243
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4262
Inparanoid 1 1.050 97 1.000 Inparanoid score I5026
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48270
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008044
OrthoInspector 1 1.000 - - oto92529
orthoMCL 1 0.900 - - OOG6_105961
Panther 1 1.100 - - LDO PTHR15314
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.890

Return to query results.
Submit another query.