DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and Parvg

DIOPT Version :9

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001155972.1 Gene:Parvg / 64099 MGIID:2158329 Length:384 Species:Mus musculus


Alignment Length:44 Identity:12/44 - (27%)
Similarity:21/44 - (47%) Gaps:9/44 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FLHCMGFSVT--------RGLNIALRLVQNSDGALSYAINTSTV 104
            |||...|.:|        ..:.:||.|::: :|..||.:|...:
Mouse   308 FLHLKEFYLTPSSPTEMLHNVTLALDLLKD-EGLFSYPVNPEDI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 39..132 CDD:289126 12/44 (27%)
ParvgNP_001155972.1 CH 98..199 CDD:278723
CH 265..365 CDD:278723 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.