DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and Y62E10A.24

DIOPT Version :9

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001379263.1 Gene:Y62E10A.24 / 36805064 WormBaseID:WBGene00302968 Length:130 Species:Caenorhabditis elegans


Alignment Length:121 Identity:40/121 - (33%)
Similarity:73/121 - (60%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRSAKYHKQQNHRVVRKQPPRPAVSDRHNIYITSKTDFKAQQRRCEELINSGAHEIFLHCMGFSV 77
            |.|.::.::.|.  :|::||....|:.::||||.||:.::|.:..||::|:...|:|:|.||.|:
 Worm     7 PSSKRFDEKTNE--MRRRPPVKPSSNPNHIYITRKTNVESQSKSTEEMLNNAFDEVFIHGMGASI 69

  Fly    78 TRGLNIALRLVQNSDGALSYAINTSTVQLVDELHPLCDAEDITFRQRNNSALHIKI 133
            .:.|..|:.:.:...|::...|.|||||..|::..|.|.:....|.|:.||:|:.:
 Worm    70 NKALVFAMEVERRFGGSVKSDIQTSTVQCTDDIVSLLDLDQSETRHRSVSAVHVHL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 39..132 CDD:289126 33/92 (36%)
Y62E10A.24NP_001379263.1 Rpp20 29..124 CDD:372048 34/94 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I3798
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48270
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008044
OrthoInspector 1 1.000 - - oto17786
orthoMCL 1 0.900 - - OOG6_105961
Panther 1 1.100 - - LDO PTHR15314
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.