powered by:
Protein Alignment Rpp20 and parvb
DIOPT Version :9
Sequence 1: | NP_001027078.1 |
Gene: | Rpp20 / 3772007 |
FlyBaseID: | FBgn0066304 |
Length: | 167 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956020.1 |
Gene: | parvb / 325686 |
ZFINID: | ZDB-GENE-030131-4411 |
Length: | 365 |
Species: | Danio rerio |
Alignment Length: | 128 |
Identity: | 28/128 - (21%) |
Similarity: | 43/128 - (33%) |
Gaps: | 38/128 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 TSKTDFKAQQRRCEELINSGAHEIFLHCMGFSVTRGLNIALRLVQNSDGALSYAINTSTVQLVDE 109
|..|...|:.::.|.|:.. :|.::.|...| :.|.:.......|||...:....|
Zfish 6 TRSTGQPAKTKKDESLLGK---------LGGTLVRKKKI--KEVSDLQEEGKNAINAPLLHTSPE 59
Fly 110 LHP------------LCD---AEDITFRQRN-------NSALH-----IKILNNSLFDIAVPQ 145
|.| :.| .||:.|:... ||.|. :|.|...|:|..|.|
Zfish 60 LLPEDTLLEENAERTILDPTSREDLNFKDLQKVLIDWINSELEEDRIIVKDLEEDLYDGQVLQ 122
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rpp20 | NP_001027078.1 |
Rpp20 |
39..132 |
CDD:289126 |
22/113 (19%) |
parvb | NP_956020.1 |
CH |
89..189 |
CDD:278723 |
9/34 (26%) |
CH |
256..357 |
CDD:278723 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3631 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.