DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and Tmem203

DIOPT Version :9

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_796318.2 Gene:Tmem203 / 227615 MGIID:2443597 Length:136 Species:Mus musculus


Alignment Length:70 Identity:17/70 - (24%)
Similarity:28/70 - (40%) Gaps:16/70 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRCEELINSGAHEIFLHCMG---FSV---------TRGL---NIALRLVQNSDGALSYAINTSTV 104
            |...:.:.....|||:|.:.   |||         |.||   |:.:.... :||..:|.....:|
Mouse     6 RELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLTPGLSWWNVFVPFFA-ADGLSTYFTTIVSV 69

  Fly   105 QLVDE 109
            :|..:
Mouse    70 RLFQD 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 39..132 CDD:289126 17/70 (24%)
Tmem203NP_796318.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.