powered by:
Protein Alignment Rpp20 and Tmem203
DIOPT Version :9
Sequence 1: | NP_001027078.1 |
Gene: | Rpp20 / 3772007 |
FlyBaseID: | FBgn0066304 |
Length: | 167 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_796318.2 |
Gene: | Tmem203 / 227615 |
MGIID: | 2443597 |
Length: | 136 |
Species: | Mus musculus |
Alignment Length: | 70 |
Identity: | 17/70 - (24%) |
Similarity: | 28/70 - (40%) |
Gaps: | 16/70 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 RRCEELINSGAHEIFLHCMG---FSV---------TRGL---NIALRLVQNSDGALSYAINTSTV 104
|...:.:.....|||:|.:. ||| |.|| |:.:.... :||..:|.....:|
Mouse 6 RELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLTPGLSWWNVFVPFFA-ADGLSTYFTTIVSV 69
Fly 105 QLVDE 109
:|..:
Mouse 70 RLFQD 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rpp20 | NP_001027078.1 |
Rpp20 |
39..132 |
CDD:289126 |
17/70 (24%) |
Tmem203 | NP_796318.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3631 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.