DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and pat-6

DIOPT Version :9

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_499891.1 Gene:pat-6 / 176848 WormBaseID:WBGene00003932 Length:375 Species:Caenorhabditis elegans


Alignment Length:188 Identity:41/188 - (21%)
Similarity:60/188 - (31%) Gaps:70/188 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RKQPPRPAVSDRHNIYITSKTDFKAQQRRCEELINSGAHEIFLHCMGFSVTRGLNIALR------ 86
            |.:|.:|.|.::    ::.....|.:....|.....|||    |.........|.:..|      
 Worm    12 RDEPKKPGVFEK----LSGTLSRKKKAPEDEHGNQGGAH----HATDEDEVLELELEGREALDQS 68

  Fly    87 ----LVQN---SDGALSYAINTST------VQLVDEL-----HPLCDAEDITFRQRNNSALHIKI 133
                |.:|   .:|.:...:...|      .|:||.|     ..|.|       ||    :.::.
 Worm    69 LVPVLARNIWLEEGEIRRYLTKETARDQKLAQVVDLLIYWLNEELAD-------QR----IVVRH 122

  Fly   134 LNNSLFD---------------IAVPQPSQS------------QTQAQSLGQFRGKAK 164
            |...|||               |.||:.|||            ||..:.|||.|.:.|
 Worm   123 LQEDLFDGQIIQKLLEKLEQIRIEVPEVSQSEEGQRQKLQIVVQTANRILGQPREQEK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 39..132 CDD:289126 20/116 (17%)
pat-6NP_499891.1 CH 103..201 CDD:278723 23/89 (26%)
CH 268..368 CDD:278723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.