DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and parvin

DIOPT Version :10

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_061506783.1 Gene:parvin / 1273600 VectorBaseID:AGAMI1_010477 Length:365 Species:Anopheles gambiae


Alignment Length:36 Identity:8/36 - (22%)
Similarity:17/36 - (47%) Gaps:4/36 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NIYIT----SKTDFKAQQRRCEELINSGAHEIFLHC 72
            |:::|    .|.:.|...:|.:|.|.....::.:.|
Mosquito   204 NVFVTVVMVQKLNGKLTSQRFQEQITQSYDDVGMRC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 42..132 CDD:372048 7/35 (20%)
parvinXP_061506783.1 None

Return to query results.
Submit another query.