DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and pop7

DIOPT Version :10

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001006004.1 Gene:pop7 / 100004610 ZFINID:ZDB-GENE-041010-88 Length:148 Species:Danio rerio


Alignment Length:110 Identity:52/110 - (47%)
Similarity:76/110 - (69%) Gaps:5/110 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VRKQPPRPAVSDRHNIYITSKTDFKAQQRRCEELINSGAH-EIFLHCMGFSVTRGLNIALRLVQN 90
            :||:.||.....|:::|:..|||||||..||::|::  || ||.:|.:|.::.|.:||||:|..:
Zfish    36 LRKRLPRKLPKRRNDVYVNMKTDFKAQLARCQKLLD--AHREICIHGLGLAINRAINIALQLQTS 98

  Fly    91 SDGALSYAINTSTVQLVDELHP--LCDAEDITFRQRNNSALHIKI 133
            |.|||..|.|||||:|:|:|.|  ..:|.:...|.|||||:|||:
Zfish    99 SQGALQLAANTSTVELIDDLEPEDPDEAGEHLTRTRNNSAIHIKV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 42..132 CDD:372048 45/92 (49%)
pop7NP_001006004.1 Rpp20 46..142 CDD:372048 46/97 (47%)

Return to query results.
Submit another query.