DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp20 and pop7

DIOPT Version :9

Sequence 1:NP_001027078.1 Gene:Rpp20 / 3772007 FlyBaseID:FBgn0066304 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001006004.1 Gene:pop7 / 100004610 ZFINID:ZDB-GENE-041010-88 Length:148 Species:Danio rerio


Alignment Length:110 Identity:52/110 - (47%)
Similarity:76/110 - (69%) Gaps:5/110 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VRKQPPRPAVSDRHNIYITSKTDFKAQQRRCEELINSGAH-EIFLHCMGFSVTRGLNIALRLVQN 90
            :||:.||.....|:::|:..|||||||..||::|::  || ||.:|.:|.::.|.:||||:|..:
Zfish    36 LRKRLPRKLPKRRNDVYVNMKTDFKAQLARCQKLLD--AHREICIHGLGLAINRAINIALQLQTS 98

  Fly    91 SDGALSYAINTSTVQLVDELHP--LCDAEDITFRQRNNSALHIKI 133
            |.|||..|.|||||:|:|:|.|  ..:|.:...|.|||||:|||:
Zfish    99 SQGALQLAANTSTVELIDDLEPEDPDEAGEHLTRTRNNSAIHIKV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp20NP_001027078.1 Rpp20 39..132 CDD:289126 46/95 (48%)
pop7NP_001006004.1 Rpp20 46..142 CDD:289126 46/97 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575906
Domainoid 1 1.000 41 1.000 Domainoid score I12499
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4262
Inparanoid 1 1.050 96 1.000 Inparanoid score I5044
OMA 1 1.010 - - QHG48270
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008044
OrthoInspector 1 1.000 - - oto39251
orthoMCL 1 0.900 - - OOG6_105961
Panther 1 1.100 - - LDO PTHR15314
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.