DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33843 and AT2G30620

DIOPT Version :9

Sequence 1:NP_001027349.1 Gene:His1:CG33843 / 3772004 FlyBaseID:FBgn0053843 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_180620.1 Gene:AT2G30620 / 817612 AraportID:AT2G30620 Length:273 Species:Arabidopsis thaliana


Alignment Length:273 Identity:100/273 - (36%)
Similarity:125/273 - (45%) Gaps:59/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDSAVATSASPVAAPPA-------TVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKN 59
            |.:|..|..||...|.|       |...|..:|....:|.||.|   .|.|||..::|:..:|..
plant    14 SGAADTTVKSPEKKPAAKGGKSKKTTTAKATKKPVKAAAPTKKK---TTSSHPTYEEMIKDAIVT 75

  Fly    60 LKERGGSSLLAIKKYITATYKCDAQKLAPFIKKY----LKSAVVNGKLIQTKGKGASGSFKLSAS 120
            ||||.|||..||:|:|...:|    .|.|..:|.    ||..|.:.||::.|     .|||: .|
plant    76 LKERTGSSQYAIQKFIEEKHK----SLPPTFRKLLLVNLKRLVASEKLVKVK-----ASFKI-PS 130

  Fly   121 AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVA---TKKTAENKK 182
            |:....||..:.|                    .||..|.|   |||.|.|.|   .|..|..|.
plant   131 ARSAATPKPAAPV--------------------KKKATVVA---KPKGKVAAAVAPAKAKAAAKG 172

  Fly   183 TEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKA-VVAKASKAKPAVSAKPKKTVK--KASVSATA 244
            |:|..||...|.. :.:||   ||||||||||: .||..||.| ||:||||...:  |||.::|.
plant   173 TKKPAAKVVAKAK-VTAKP---KAKVTAAKPKSKSVAAVSKTK-AVAAKPKAKERPAKASRTSTR 232

  Fly   245 KKPKAKTTA-AKK 256
            ..|..|..| |||
plant   233 TSPGKKVAAPAKK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33843NP_001027349.1 Linker_histone 46..118 CDD:278939 28/75 (37%)
AT2G30620NP_180620.1 H15 59..124 CDD:197772 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I2109
OMA 1 1.010 - - QHG55300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.