DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33843 and H1f1

DIOPT Version :9

Sequence 1:NP_001027349.1 Gene:His1:CG33843 / 3772004 FlyBaseID:FBgn0053843 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_085112.1 Gene:H1f1 / 80838 MGIID:1931523 Length:213 Species:Mus musculus


Alignment Length:245 Identity:98/245 - (40%)
Similarity:123/245 - (50%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSA-VATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERG 64
            ||::| ||.:||.....||..:|   .||.:.:|..:.|     |:.|...:::..::.:.|||.
Mouse     1 MSETAPVAQAASTATEKPAAAKK---TKKPAKAAAPRKK-----PAGPSVSELIVQAVSSSKERS 57

  Fly    65 GSSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPK 128
            |.||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||:|||||:          
Mouse    58 GVSLAALKKSLAAAGY--DVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLN---------- 110

  Fly   129 AKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKK 193
                     ||.:||.:.:|   ||.|..|.||| ||||.....|.|||.:..|..| |...:||
Mouse   111 ---------KKAESKAITTK---VSVKAKASGAA-KKPKKTAGAAAKKTVKTPKKPK-KPAVSKK 161

  Fly   194 TGIIKSKPAATKAKVTA---AKPKAVVAKASKA---KPAVSAKPKKTVKK 237
            |.....||...|||..|   ||.|||..|||||   ||...|||||...|
Mouse   162 TSKSPKKPKVVKAKKVAKSPAKAKAVKPKASKAKVTKPKTPAKPKKAAPK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33843NP_001027349.1 Linker_histone 46..118 CDD:278939 32/72 (44%)
H1f1NP_085112.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 16/49 (33%)
H15 40..121 CDD:238028 37/101 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..213 49/105 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10384
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.