DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33843 and si:ch211-103n10.5

DIOPT Version :9

Sequence 1:NP_001027349.1 Gene:His1:CG33843 / 3772004 FlyBaseID:FBgn0053843 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001373259.1 Gene:si:ch211-103n10.5 / 559526 ZFINID:ZDB-GENE-030131-5155 Length:176 Species:Danio rerio


Alignment Length:228 Identity:74/228 - (32%)
Similarity:109/228 - (47%) Gaps:56/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLL 69
            :.|.:::|.:||      |..:::      :||||:.|:.|     .::...:.:.|||||.||:
Zfish     2 STAAASAPTSAP------KTPKRR------SKAKKSGASVS-----DLILKIVSSSKERGGVSLV 49

  Fly    70 AIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKL-SASAKKEKDPKAKSK 132
            |:||.:.|. |  |..|....:|..::..|.||:||||||.|||||||: |.:|||.|..|||.|
Zfish    50 ALKKALVANGY--DVVKNNSRVKLAVRRLVANGRLIQTKGTGASGSFKIGSKAAKKPKKAKAKRK 112

  Fly   133 VLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGII 197
            .....|:..:||.|..|              |.||.::          :|..|:..| |.:|..:
Zfish   113 TPKKAKRKTTKKPAGAK--------------KSPKKRR----------RKVLKSPEK-ADETAAV 152

  Fly   198 KSKPAATKAKVTAAKPKAVVAKASKAKPAVSAK 230
            |..|          :||....:|||...|.:||
Zfish   153 KKSP----------RPKRAKRRASKTSRARTAK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33843NP_001027349.1 Linker_histone 46..118 CDD:278939 31/73 (42%)
si:ch211-103n10.5NP_001373259.1 Linker_histone 28..97 CDD:395429 32/75 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm6549
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.