DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33843 and MGC69473

DIOPT Version :9

Sequence 1:NP_001027349.1 Gene:His1:CG33843 / 3772004 FlyBaseID:FBgn0053843 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001001233.1 Gene:MGC69473 / 407914 XenbaseID:XB-GENE-982799 Length:234 Species:Xenopus tropicalis


Alignment Length:211 Identity:71/211 - (33%)
Similarity:96/211 - (45%) Gaps:39/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKY 93
            :||||..|.||.:....:   .|:|..:|:.|.||.||||..|..........|.|....::|..
 Frog    62 SSGSAKKKKKKKNQPGRY---SQLVVDTIRKLGERNGSSLAKIYSEAKKVAWFDQQNGRTYLKYS 123

  Fly    94 LKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTA 158
            :|:.|.|..|:|.||.||:|||:|:         |.|.:.|..|||      |:......||:.|
 Frog   124 IKALVQNDTLLQVKGVGANGSFRLN---------KKKLEGLPFEKK------AAPPAKPPSKRRA 173

  Fly   159 VGAADKKPKA-KKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASK 222
            ..|:....|: |||   |.|||.:|.:|:..|            |.:|:....||.|.|   ...
 Frog   174 PAASSSPAKSHKKA---KPTAEKEKPQKSSVK------------APSKSHKKGAKGKKV---KKG 220

  Fly   223 AKPAVSAKPKKTVKKA 238
            |||:|...||.  |||
 Frog   221 AKPSVPKVPKS--KKA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33843NP_001027349.1 Linker_histone 46..118 CDD:278939 26/71 (37%)
MGC69473NP_001001233.1 Linker_histone 79..148 CDD:306920 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.