DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33843 and hil-6

DIOPT Version :9

Sequence 1:NP_001027349.1 Gene:His1:CG33843 / 3772004 FlyBaseID:FBgn0053843 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_503554.1 Gene:hil-6 / 186584 WormBaseID:WBGene00001857 Length:190 Species:Caenorhabditis elegans


Alignment Length:207 Identity:84/207 - (40%)
Similarity:105/207 - (50%) Gaps:25/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |||.|||  .:|....|.         ||..:..||..|.....:|||...||.|:|.:||||.|
 Worm     1 MSDVAVA--ETPAVKTPT---------KAPKANATKVPKVKTAAAHPPFINMVTAAISSLKERKG 54

  Fly    66 SSLLAIKKYITATYKCDAQ--KLAPFIKKYLKSAVVNGKLIQTKGKGASGSF----KLSASAKKE 124
            ||.:||.|||||.||...|  |:...::..||..|.:..|:||.|.||:|.|    |.:|:|||.
 Worm    55 SSKIAILKYITANYKLGDQVKKINSNLRSALKKGVASKALVQTVGTGATGRFRVAEKTAATAKKP 119

  Fly   125 KDPKAKS--KVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAK 187
            ...||.:  ||    ||...||..:||.|...||........||.|||  |||..::....:||.
 Worm   120 TVKKAATGEKV----KKTVVKKTVAKKTGDKVKKAKSPKKIAKPAAKK--ATKSPSKKVAPKKAA 178

  Fly   188 AKDAKKTGIIKS 199
            ||.||||..:|:
 Worm   179 AKPAKKTAALKA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33843NP_001027349.1 Linker_histone 46..118 CDD:278939 37/77 (48%)
hil-6NP_503554.1 Linker_histone 35..109 CDD:278939 36/73 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6615
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm4774
orthoMCL 1 0.900 - - OOG6_110754
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.