DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and GILP

DIOPT Version :9

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001330776.1 Gene:GILP / 831158 AraportID:AT5G13190 Length:141 Species:Arabidopsis thaliana


Alignment Length:95 Identity:22/95 - (23%)
Similarity:40/95 - (42%) Gaps:24/95 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PPS--YEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEIETTTKIRRRWIAYVASGIVLFTTC 74
            ||:  |.:.:|...:::      :..:|.:...|..|.:  ...|.:|.:      .|:.....|
plant    26 PPNAIYGDPLGAPIQQT------IYRDTPAPFNCLYCGN--TGLTNLRSK------PGVAAVVAC 76

  Fly    75 GIG-----CWLIPCILDC-FNEIHHSCPVC 98
            .:.     |:|.|. :|| :|:.|| ||.|
plant    77 MMPFMLGFCFLCPS-MDCLWNKQHH-CPQC 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 17/67 (25%)
GILPNP_001330776.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.