DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13559 and Litaf

DIOPT Version :9

Sequence 1:	NP_611801.1	Gene:	CG13559 / 37720	FlyBaseID:	FBgn0034870	Length:	114	Species:	Drosophila melanogaster
Sequence 2:	NP_064364.1	Gene:	Litaf / 56722	MGIID:	1929512	Length:	161	Species:	Mus musculus

Alignment Length:	142	Identity:	32/142 - (22%)
Similarity:	48/142 - (33%)	Gaps:	45/142 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 VPSTPPPSYEEAMGWET--------------------------RRSHSTTWLLAENTSSL----- 40
            |..|.||:|||.:|..:                          ..|:.|..:...|.:::
Mouse    15 VVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTV 79

  Fly    41 --------------MICPMCHDEIETTTKIRRRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEI 91
                          |.||.|...|.|........:.:::.|.:....|..||..||..:|...::
Mouse    80 YVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDV 144

  Fly    92 HHSCPVCKATLG 103
            .|.||.|||.||
Mouse   145 DHYCPNCKALLG 156

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13559	NP_611801.1	LITAF	38..107	CDD:197841	21/85 (25%)
Litaf	NP_064364.1	PPxY motif	20..23		2/2 (100%)
		zf-LITAF-like	91..159	CDD:371158	21/66 (32%)
		Membrane-binding amphipathic helix. /evidence=ECO:0000305	111..134		4/22 (18%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000358
OrthoInspector	1	1.000	-	-		mtm11118
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23292
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	4.010