DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and si:ch211-157c3.4

DIOPT Version :9

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001157840.1 Gene:si:ch211-157c3.4 / 561592 ZFINID:ZDB-GENE-030131-8454 Length:149 Species:Danio rerio


Alignment Length:107 Identity:27/107 - (25%)
Similarity:50/107 - (46%) Gaps:10/107 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSFARVPSTPPPSYEEAMGWETRRSHST--TWLLAENTSSLMICPMCHDEIETTTKIRRRWIAYV 64
            :|.|:|.|:.|   .::...|.|..:.:  ::.|... .::..|..|..::.|....:....|::
Zfish    42 ASHAQVASSRP---VQSQSTEARNKYVSYESYELGRK-PAMATCTSCQQQVLTNVTYKVGVYAWL 102

  Fly    65 ASGIVLFTTCG--IGCWLIPCILDCFNEIHHSCPVCKATLGI 104
            ...::.|  ||  :||.|||..:..|.:.:||||.|...|.:
Zfish   103 MCILIFF--CGFVLGCCLIPFFMKFFKDAYHSCPRCNKILHV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 19/69 (28%)
si:ch211-157c3.4NP_001157840.1 zf-LITAF-like 75..142 CDD:287559 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm6622
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.