DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and CG13516

DIOPT Version :9

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster


Alignment Length:109 Identity:28/109 - (25%)
Similarity:42/109 - (38%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFARVPSTPPP--SYEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEIET----TTKIRRR 59
            :|:.|..|:.|||  ..|:..........:.|..|..|.|. ::||.|.....|    |...|..
  Fly    56 VSAPAIAPARPPPVVVVEQPAPQPPTVVPTDTLHLGPNRSR-VLCPACGANKTTRMTHTANSRTH 119

  Fly    60 WIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKATLG 103
            .:|.:   :.|...|...|::..|:..| ...:|.|..|...||
  Fly   120 MVAGL---LCLVGFCCCACFVPYCMNSC-RTGNHYCRKCNTFLG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 18/70 (26%)
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D155863at50557
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.