DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and CG42565

DIOPT Version :9

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001286738.1 Gene:CG42565 / 37598 FlyBaseID:FBgn0260767 Length:135 Species:Drosophila melanogaster


Alignment Length:137 Identity:31/137 - (22%)
Similarity:43/137 - (31%) Gaps:38/137 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFARVPSTPP--------PSYEEAMGWETRR-----------------------SHSTTWLLA 34
            |..:.||.|.||        |..|:.|......                       .|..|.:|.
  Fly     1 MRCYKRVDSPPPYSDPFATAPPAEDVMQQNLASPAHPNPVIPVMAQTMPVLQPVSVMHHQTTVLV 65

  Fly    35 ENTSSLMICPMCHDEIETTTKIRRRWIAYVASGIVLFTTCGIGCW---LIPCILDCFNEIHHSCP 96
            :||....|||.|:..|....:.......|..:.::    |...||   ..||..:|..:....||
  Fly    66 DNTRQGTICPHCNARIRLRVEHHPTGSTYCMAALL----CLFLCWPCVCAPCCCNCCYKTSQYCP 126

  Fly    97 VCKATLG 103
            .|.:.||
  Fly   127 NCNSCLG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 17/69 (25%)
CG42565NP_001286738.1 zf-LITAF-like 72..135 CDD:287559 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.