DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and CDIP1

DIOPT Version :9

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001185983.1 Gene:CDIP1 / 29965 HGNCID:13234 Length:208 Species:Homo sapiens


Alignment Length:116 Identity:29/116 - (25%)
Similarity:45/116 - (38%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PPPSYEEAMG-----------WETRRSHSTTWLLAENTSSLM---------------ICPMCHDE 49
            |||.....||           :.....|:.|.|:....::.:               :||.|...
Human    84 PPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQA 148

  Fly    50 IETTTKIRRRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKA 100
            |.|........:.:|......|..|.:||.||||:::.|.::.|:||.|||
Human   149 ITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 21/78 (27%)
CDIP1NP_001185983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
zf-LITAF-like 137..203 CDD:313756 21/63 (33%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 164..184 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.