DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and CDIP1

DIOPT Version :10

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_037531.2 Gene:CDIP1 / 29965 HGNCID:13234 Length:208 Species:Homo sapiens


Alignment Length:116 Identity:29/116 - (25%)
Similarity:45/116 - (38%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PPPSYEEAMG-----------WETRRSHSTTWLLAENTSSLM---------------ICPMCHDE 49
            |||.....||           :.....|:.|.|:....::.:               :||.|...
Human    84 PPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQA 148

  Fly    50 IETTTKIRRRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKA 100
            |.|........:.:|......|..|.:||.||||:::.|.::.|:||.|||
Human   149 ITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 21/78 (27%)
CDIP1NP_037531.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
zf-LITAF-like 137..205 CDD:463165 21/63 (33%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 164..184 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.