DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and LITAFD

DIOPT Version :9

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_011521084.1 Gene:LITAFD / 101929989 HGNCID:53927 Length:121 Species:Homo sapiens


Alignment Length:98 Identity:24/98 - (24%)
Similarity:41/98 - (41%) Gaps:13/98 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PSTPPPSYEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEIETTTKI---RRRWIAYVASGIV 69
            ||..|       ||...|.::...::..:.....:||.|.:.|.|.|..   ...|:  :.:.:.
Human    28 PSRAP-------GWNHPRLYAGMSVVGTSMPVQAVCPYCGNRIITVTTFVPGALTWL--LCTTLF 83

  Fly    70 LFTTCGIGCWLIPCILDCFNEIHHSCPVCKATL 102
            ||... :||..:...:....::.||||||:..|
Human    84 LFGYV-LGCCFLAFCIRSLMDVKHSCPVCQREL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 18/68 (26%)
LITAFDXP_011521084.1 zf-LITAF-like 51..119 CDD:371158 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.