powered by:
Protein Alignment CG13559 and LOC100498592
DIOPT Version :9
Sequence 1: | NP_611801.1 |
Gene: | CG13559 / 37720 |
FlyBaseID: | FBgn0034870 |
Length: | 114 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002939494.2 |
Gene: | LOC100498592 / 100498592 |
-ID: | - |
Length: | 193 |
Species: | Xenopus tropicalis |
Alignment Length: | 56 |
Identity: | 15/56 - (26%) |
Similarity: | 26/56 - (46%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 CPMCHDEIETTTKIRRRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVC 98
|..|..::.|.|:.....:..:...|::...|..||.|||..:....:::|.||.|
Frog 127 CSFCQSQVRTRTEYTIGSLTVILFLIIILFGCWFGCCLIPFFVQHCKDVNHFCPNC 182
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1564782at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000358 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23292 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.020 |
|
Return to query results.
Submit another query.