DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13559 and litafd

DIOPT Version :9

Sequence 1:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_002939491.1 Gene:litafd / 100498168 XenbaseID:XB-GENE-22164436 Length:141 Species:Xenopus tropicalis


Alignment Length:101 Identity:29/101 - (28%)
Similarity:42/101 - (41%) Gaps:6/101 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSFARVPSTPPPSYEEAMGWETRRSHSTTWLLA----ENTSSLMICPMCHDEIETTTKIRRRWIA 62
            ||.|..|  |||.|....|.........|.::.    ::|.:...||.|...|.|........:.
 Frog    33 SSGAVYP--PPPVYNSIPGQPVTVPPVVTPIIVTSTFQDTPASTTCPSCRQNIITNIHYNIGLLT 95

  Fly    63 YVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVC 98
            ::..||:....|.:||.|||..:|...::.|.||.|
 Frog    96 WLLFGILFIFGCWLGCCLIPFCVDSCKDVDHYCPNC 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13559NP_611801.1 LITAF 38..107 CDD:197841 18/61 (30%)
litafdXP_002939491.1 zf-LITAF-like 70..139 CDD:371158 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.