DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33855 and AT5G08780

DIOPT Version :9

Sequence 1:NP_001027369.1 Gene:His1:CG33855 / 3771991 FlyBaseID:FBgn0053855 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_680160.2 Gene:AT5G08780 / 830778 AraportID:AT5G08780 Length:457 Species:Arabidopsis thaliana


Alignment Length:267 Identity:58/267 - (21%)
Similarity:92/267 - (34%) Gaps:82/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYK------------------------C 81
            |.||.||....|:..:|.:|.:.||:|..||.::|.:.||                        |
plant    50 SRTPDHPTYSAMIFIAIMDLNKEGGASEDAISEFIKSKYKNLPFAHTNLLSHHLAKLVEKREILC 114

  Fly    82 DAQK---LAPFIKKYLKSAVVNGK--LIQTKGKGASGSFKLSASAKKEK--------DPKAKSKV 133
            |...   ..|..||.:.|..|..|  ||..:......:.::.....||:        |||.   |
plant   115 DCNNDCYSLPGEKKTVASTDVQRKSDLITVRTNDQRAADEVMTCQNKEESVEILKSGDPKV---V 176

  Fly   134 LSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTE----KAKAKDA--- 191
            |..|:.:...:..||                    :||.......|...||    ||..:|:   
plant   177 LLEEQSLTKSRTGSK--------------------RKACCVINVIEVMDTEDNGFKAGLRDSTVQ 221

  Fly   192 --KKTGIIK---SKPAATKAKVTAAK------PKAVIAKASKAKPAVSAK----PKKTVKKASVS 241
              :|.|:::   .:.:..:|::.|..      ..||:.|.:......|.|    ....|:||.:.
plant   222 IPRKEGVVEVVDVENSENEARIEANSRGGELYEVAVLYKQNDVLMEESGKEAMETSSIVRKAKLR 286

  Fly   242 ATAKKPK 248
            .|:...|
plant   287 RTSNTTK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33855NP_001027369.1 Linker_histone 46..118 CDD:278939 23/100 (23%)
AT5G08780NP_680160.2 H15 52..113 CDD:197772 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.