DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33855 and H1f5

DIOPT Version :9

Sequence 1:NP_001027369.1 Gene:His1:CG33855 / 3771991 FlyBaseID:FBgn0053855 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_064418.1 Gene:H1f5 / 56702 MGIID:1861461 Length:223 Species:Mus musculus


Alignment Length:269 Identity:105/269 - (39%)
Similarity:131/269 - (48%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::|.|.:|:     ||.|||...:||.:..||...:||:.    ||..:::..::...|||||
Mouse     1 MSETAPAETAA-----PAPVEKSPAKKKTTKKAGAAKRKATG----PPVSELITKAVSASKERGG 56

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.| .|  |.:|....||..|||.|..|.|:||||.||||||||:   ||....:|
Mouse    57 VSLPALKKALAAGGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN---KKAASGEA 116

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKK- 193
            |.|              :||.|.:..|...||..|||        ||||..|||.|...|.||| 
Mouse   117 KPK--------------AKKTGAAKAKKPAGATPKKP--------KKTAGAKKTVKKTPKKAKKP 159

  Fly   194 --TGIIKSKPAATKAKVTA---------AKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKKP 247
              .|:.|...:..|||..|         ||||||.:||||.|   ..|||        :|..|..
Mouse   160 AAAGVKKVAKSPKKAKAAAKPKKAAKSPAKPKAVKSKASKPK---VTKPK--------TAKPKAA 213

  Fly   248 KAKTTAAKK 256
            |||...:||
Mouse   214 KAKKAVSKK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33855NP_001027369.1 Linker_histone 46..118 CDD:278939 35/72 (49%)
H1f5NP_064418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 21/63 (33%)
Linker_histone 38..108 CDD:278939 35/71 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..223 67/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10384
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.