DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33855 and H1f9

DIOPT Version :9

Sequence 1:NP_001027369.1 Gene:His1:CG33855 / 3771991 FlyBaseID:FBgn0053855 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_061262.1 Gene:H1f9 / 54388 MGIID:2136691 Length:170 Species:Mus musculus


Alignment Length:140 Identity:35/140 - (25%)
Similarity:58/140 - (41%) Gaps:34/140 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PSHPPTQQMVDASIKNLKERGGS----------------SLLAIKKYITATYKCDAQKLAPFIKK 92
            ||...:|...|.|.::|::...|                ||..:||.::.|..........| |:
Mouse    17 PSQSESQTESDISTQSLRKPTMSYVILKTLADKRVHNCVSLATLKKAVSITGYNMTHNTWRF-KR 80

  Fly    93 YLKSAVVNGKLIQ-TKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQSKKVASKKIG----- 151
            .|::.:..|.::. |..||||||..|.    ||:..|:..:....:.:.:|:|  .:|.|     
Mouse    81 VLQNLLDKGMIMHVTCCKGASGSLCLC----KERALKSNHRAKRCQDRQKSQK--PQKPGQRESE 139

  Fly   152 -----VSSKK 156
                 :||||
Mouse   140 PCQLLLSSKK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33855NP_001027369.1 Linker_histone 46..118 CDD:278939 21/88 (24%)
H1f9NP_061262.1 H15 35..103 CDD:294056 15/68 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..140 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.