DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33855 and H1-6

DIOPT Version :10

Sequence 1:NP_001027369.1 Gene:His1:CG33855 / 3771991 FlyBaseID:FBgn0053855 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005314.2 Gene:H1-6 / 3010 HGNCID:4720 Length:207 Species:Homo sapiens


Alignment Length:108 Identity:25/108 - (23%)
Similarity:39/108 - (36%) Gaps:37/108 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVTVISVLGAIHQVKSHEDQPLSGIAVHKITFGLNEKAYV---------KASPTVLGS--NGQH- 61
            ::.:.|..|.|..:    |.|:..:..| ::.|.   |||         ||...:.|.  :||. 
Human   177 IMEIFSTYGKIKMI----DMPVERMHPH-LSKGY---AYVEFENPDEAEKALKHMDGGQIDGQEI 233

  Fly    62 -SELVLVQYSSPKPSDDDWIGVFSPADFNASTCPGDNKMVQPP 103
             :..||..:..|.|..      |||          ..:|:.||
Human   234 TATAVLAPWPRPPPRR------FSP----------PRRMLPPP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33855NP_001027369.1 H15 43..130 CDD:238028 18/74 (24%)
H1-6NP_005314.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
H15 43..126 CDD:238028
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..207 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.