DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33855 and si:dkey-108k21.21

DIOPT Version :9

Sequence 1:NP_001027369.1 Gene:His1:CG33855 / 3771991 FlyBaseID:FBgn0053855 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_005170784.2 Gene:si:dkey-108k21.21 / 100332815 ZFINID:ZDB-GENE-131127-5 Length:271 Species:Danio rerio


Alignment Length:239 Identity:94/239 - (39%)
Similarity:127/239 - (53%) Gaps:40/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|.|.:|:|..||          ||.|.|   |.|||.     |..:.::..::...|:|.|
Zfish    66 MAETAPAPAATPAKAP----------KKRSAS---KLKKAG-----PNVRDLIVKTVTASKDRHG 112

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.::| .|  |.:|....:|..:|:.|:||.|:|.||.||||||||:   ||:.:||.
Zfish   113 VSLAALKKALSAGGY--DVEKNNSRVKTAVKALVLNGTLVQPKGTGASGSFKLN---KKQAEPKK 172

  Fly   130 KSKVLSAE-KKVQSKKVASKKIGVSSKK---TAVGAADKKP-KAKKAVATKKTAENKKTEKAKAK 189
            .:|..:|: ||..:||.|:||.....||   |:|..|.|.| ||||..|.||..::.|  |||..
Zfish   173 AAKKTAAKAKKPAAKKPAAKKSPKKVKKPAATSVKKATKSPKKAKKPAAAKKATKSPK--KAKKP 235

  Fly   190 DAKKTGIIKSKPAATKAKVTAAKPKAVIAKASKAKPAVSAKPKK 233
            .|.|      |.|.:..||.|.|||....||:|.|   .|.|||
Zfish   236 AAAK------KAAKSPKKVKAVKPKTAKPKAAKPK---KAAPKK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33855NP_001027369.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
si:dkey-108k21.21XP_005170784.2 Linker_histone 94..164 CDD:306920 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.