DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pif1B and acanb

DIOPT Version :9

Sequence 1:NP_001027155.1 Gene:Pif1B / 3771985 FlyBaseID:FBgn0046874 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_021326217.1 Gene:acanb / 559593 ZFINID:ZDB-GENE-100422-16 Length:1376 Species:Danio rerio


Alignment Length:417 Identity:92/417 - (22%)
Similarity:135/417 - (32%) Gaps:144/417 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 TSKSSNFRAPNPRNQPSFGPGDETSATTRSQSIVGQVTCLCASEHQPTKAFVSSLADRECPNEIQ 332
            :..||.|.:.:     :||.| ..||:.....|...:      |..|..||.||.|         
Zfish   918 SGSSSGFESSS-----AFGFG-SGSASGFGSGIASGI------ESSPASAFGSSSA--------- 961

  Fly   333 IAPCPSTRIHHPSGFAQFTDCQNSQGDPSTSFRSRKVSVKGQEEFCD---CDASDNFSE------ 388
                        |||.. :.....:...::.|:|  |||.|...:.:   .:.|:|...      
Zfish   962 ------------SGFGS-SSAIGLESSSASVFKS--VSVTGTSGYPNHPSGEVSENIQRQDGEMI 1011

  Fly   389 -LSDPIQTSLHTHRSLSG-----GSCLCNDDADPPKEP--EKATCVSKQCQCSSNDELQGMQSAQ 445
             .:|...|.| |.|..:|     ||...:.:...| ||  |.:..||......|||.|       
Zfish  1012 IFTDDEVTEL-TLRPTAGTEQGRGSVEISGEGSTP-EPYTEDSISVSNSTSHESNDLL------- 1067

  Fly   446 AGTGYQTPEDLCGNRAMACCSRKERILMLMEKL----TSPGCDCGISRPCLTQQLFRELTLLLRS 506
                   ||            |.|:|.:.||..    .||......:.|.||......|. :.:|
Zfish  1068 -------PE------------RDEKISVTMEAFDVTDKSPLITTPTNIPVLTTPSSASLQ-MPKS 1112

  Fly   507 EKDDAV--APADEASP-PCLTFDECCTAQ--------HAG-NGEGDPVEKPPSKRELQRVE-CFH 558
            ..:.:|  ||:|...| ||  ....|:.|        |:| :||...|          .|: |..
Zfish  1113 TMNPSVNEAPSDPCDPNPC--GQGLCSLQDGVALCQCHSGFSGENCSV----------LVQGCAE 1165

  Fly   559 QLEEYLCKCFL--------PPAEPQIPETDIYAFEL----------------------DPDFPPE 593
            ...|::..|::        ..||....|.:.:...:                      |.|...|
Zfish  1166 GWMEFMGSCYIHFDERETWTSAEQHCQELNSHLVSISSQQEQEFVKTQAQDYQWIGLNDKDVQNE 1230

  Fly   594 PE--PKSPKENDNMQPCQCPEQFFDIG 618
            ..  ..||.|.:|.:|.| |:.:|..|
Zfish  1231 FRWTDGSPLEYENWRPNQ-PDNYFSTG 1256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pif1BNP_001027155.1 None
acanbXP_021326217.1 Ig 45..159 CDD:325142
Link_domain_CSPGs_modules_1_3 158..252 CDD:239594
Link_domain_CSPGs_modules_2_4 260..354 CDD:239597
Xlink 459..553 CDD:306661
Link_domain_CSPGs_modules_2_4 560..655 CDD:239597
CLECT 1163..1284 CDD:321932 18/95 (19%)
CCP 1290..1347 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NBU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.