DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT1G20270

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:239 Identity:61/239 - (25%)
Similarity:110/239 - (46%) Gaps:52/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 NTSTTP-----FTRIAPLKMEELG-----------LDPYMVVFHDVIYDTEIDGMLNSSDFGLSE 328
            |..::|     |.|.|..:.|.||           .:|...|:|:.:...|.:.:::.:...:.:
plant    46 NDESSPIDLSYFRRAATERSEGLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVK 110

  Fly   329 SVSGLKSEVRTSKDSHIVDA-------------KTLNERVTDMTGLSMEMSDPFSLINYGLGGHF 380
            | :.:.||...||||.:..:             ||:.:|:.|.|.:..:..:...:::|..|..:
plant   111 S-TVVDSETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKY 174

  Fly   381 ILHHD-FHEYTNTTRLKQGDRIATVLFYLREVDSGGATVFPMLN-------------------IT 425
            ..|:| |.:..||.  ..|.|:||:|.||.:|:.||.||||..|                   ::
plant   175 EPHYDYFVDEFNTK--NGGQRMATMLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLS 237

  Fly   426 VMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKYVLTKWIN 469
            |.|:.|.|:.::::.....::..:||..||||.|:|:..|||::
plant   238 VKPRMGDALLFWSMRPDATLDPTSLHGGCPVIRGNKWSSTKWMH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 49/186 (26%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 53/206 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.