DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT5G66060

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:206 Identity:55/206 - (26%)
Similarity:96/206 - (46%) Gaps:32/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 MEELGLDPYMVVFHDVIYDTEIDGMLNSSDFGLSESV-------SGLKSEVRTSKDSHIVDA--K 349
            :|.:..:|...|:|:.:...|...::..:...:.:|.       ....|.||||..:.:...  |
plant    78 VEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDK 142

  Fly   350 TLNE---RVTDMTGLSMEMSDPFSLINYGLGGHFILHHDFHEYTNTTRLKQGDRIATVLFYLREV 411
            |:.|   |::|.|.:.:|..:...:::|.:|..:..|:|:......|| ..|.||||||.||.:|
plant   143 TIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTR-NGGQRIATVLMYLSDV 206

  Fly   412 DSGGATVFPML-------------------NITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPVI 457
            :.||.||||..                   .::|.||.|.|:.::::.....::..:||..|.||
plant   207 EEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCAVI 271

  Fly   458 SGSKYVLTKWI 468
            .|:|:..|||:
plant   272 KGNKWSSTKWL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 50/184 (27%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 55/206 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.