DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT4G35820

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:235 Identity:59/235 - (25%)
Similarity:102/235 - (43%) Gaps:58/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 LATTQNCTAVVQKPSKKLHCRYNTSTTPFTRIAPLKMEELGLDPYMVVFHDVI--------YDTE 314
            |.||..|:.|....|.:.         |..|    .:|.:..:|...|:|:.:        .:.|
plant    65 LLTTLTCSMVKVAASLRF---------PNER----WLEVITKEPRAFVYHNFLALFFKICKTNEE 116

  Fly   315 IDGMLNSSDFGLSES-----VSGL--KSEVRTS-----KDSHIVDAKTLNERVTDMTGLSMEMSD 367
            .|.:::.:...::.|     ::||  :|..|||     :..|....|.:.:|:::.|.:..|..:
plant   117 CDHLISLAKPSMARSKVRNALTGLGEESSSRTSSGTFIRSGHDKIVKEIEKRISEFTFIPQENGE 181

  Fly   368 PFSLINYGLGGHFILHHDFHEYTNTTRLKQGDRIATVLFYLREVDSGGATVFP-------MLNIT 425
            ...:|||.:|..|..|.|..:           ||||||.||.:||.||.||||       ...::
plant   182 TLQVINYEVGQKFEPHFDGFQ-----------RIATVLMYLSDVDKGGETVFPEAKGIKSKKGVS 235

  Fly   426 VMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKYVLT 465
            |.||||.|:.::::...|:.:..:.|       |.::.|:
plant   236 VRPKKGDALLFWSMRPDGSRDPSSKH-------GKRHCLS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 47/171 (27%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 5/11 (45%)
P4Hc 115..262 CDD:214780 45/164 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.